Product Name: Human CCL14 (HCC-1)
|
BACKGROUND
Hemofiltrate CC chemokine-1 (HCC-1/CCL14) is endogeneously expressed by numerous tissues. Upon processing of the N terminal residues of the full length HCC-1 by the uPA-plasmin system, the active form of HCC-1 (made by ChemoTactics) is a strong agonist for CCR1, CCR5 and to a lesser extent CCR3, and causes chemotaxis of different types of leukocytes. The active form of HCC-1 is also shown as a potent inhibitor of HIV entry. Also available biotinylated: Human Biotinylated B-CCL14 |
|
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
SPECIFICATIONS
Source: E. coli derived Accession # P16627 (28-93) Modification: None Formulation: Lyophilized Predicted Molecular Mass: 7.801 kDa Extinction Coefficient: 13,850 M-1 cm-1 Actual Molecular Mass: 7.801 kDa by ESI Mass Spec Protein Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTN PSDKWVQDYIKDMKEN Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE Carrier Protein: None |
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.
Migration Assay Protocol Activity: EC50 = 0.1-0.4 nM determined by Migration Assay with cells expressing recombinant CCR1
|
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
REFERENCES
1. “HCC-1, a novel chemokine from human plasma” Schulz-Knappe P., Mägert H., Dewald B., J Exp Med 183:295-299 (1996)
2. “Urokinase Plasminogen Activator and Plasmin Efficiently Convert Hemofiltrate CC Chemokine 1 into Its Active [9–74] Processed Variant” Vakili J., Standker L., Detheux M., Vassart, G., Forssmann W., Parmentier M. J Immunol 167:3406-3413 (2001)
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
REFERENCES
1. “HCC-1, a novel chemokine from human plasma” Schulz-Knappe P., Mägert H., Dewald B., J Exp Med 183:295-299 (1996)
2. “Urokinase Plasminogen Activator and Plasmin Efficiently Convert Hemofiltrate CC Chemokine 1 into Its Active [9–74] Processed Variant” Vakili J., Standker L., Detheux M., Vassart, G., Forssmann W., Parmentier M. J Immunol 167:3406-3413 (2001)
Support: info@chemotactics.com
For Research use only, Not for use in Humans.
ChemoTactics, Inc - Carlsbad, CA
6076 Corte del Cedro Carlsbad, CA 92011
6076 Corte del Cedro Carlsbad, CA 92011