|
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
SPECIFICATIONS
Source: E. coli derived Accession # Q9Y4X3 (25-112) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 10.149 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 10.149kDa by ESI Mass Spec Protein Sequence: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP SLSQWFEHQERKLHGTLPKLNFGMLRKMG Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE |
Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells.
Migration Assay Protocol Activity: EC50 = 34nM determined by migration assay with cells expressing recombinant CCR10
|
PREPARATION AND STORAGE
Reconstituion: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
REFERENCES
1. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Homey et al. Nature Med. 8: 157-165 (2002)
2. Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus. Ishikawa-Mochizuki et al. FEBS Lett. 460:544-548 (1999)
3. The Chemokine ESkine/CCL27 Displays Novel Modes of Intracrine and Paracrine Function. Gortz A. et al. J Immunol. 169:1387-1394 (2002)
Reconstituion: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
REFERENCES
1. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Homey et al. Nature Med. 8: 157-165 (2002)
2. Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus. Ishikawa-Mochizuki et al. FEBS Lett. 460:544-548 (1999)
3. The Chemokine ESkine/CCL27 Displays Novel Modes of Intracrine and Paracrine Function. Gortz A. et al. J Immunol. 169:1387-1394 (2002)