Human CCL3 (MIP-1α)
|
BACKGROUND
Macrophage inflammatory proteins 1-α (MIP-1α/CCL3) binds to cell surface receptors CCR1 and CCR5. It is a proinflammatory chemokine, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection. Also available biotinylated: Human Biotinylated B-CCL3 |
|
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
SPECIFICATIONS
Source: E. coli derived Accession # P10147 (24-92) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 7.716 kDa Extinction Coefficient: 10,010 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec Protein Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWVQKYVSDLELSA Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE |
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1α. Responses are expressed as the % of total input cells.
Migration Assay Protocol Activity: EC50 = 0.1-0.3 nM determined by migration assay with cells expressing recombinant CCR5
|
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
REFERENCES
1. “Macrophage inflammatory protein-1” Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)
2. “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells” Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. “Identification and characterization of an inhibitor of haemopoietic stem cell proliferation” Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)
4. “Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors” Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
REFERENCES
1. “Macrophage inflammatory protein-1” Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)
2. “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells” Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. “Identification and characterization of an inhibitor of haemopoietic stem cell proliferation” Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)
4. “Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors” Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)