Human CCL14 (HCC-1)
|
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
|
SPECIFICATIONS
Source: E. coli derived Accession # P16627 (28-93) Modification: None Formulation: Lyophilized Predicted Molecular Mass: 7.801 kDa Extinction Coefficient: 13,850 M-1 cm-1 Actual Molecular Mass: 7.801 kDa by ESI Mass Spec Protein Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTN PSDKWVQDYIKDMKEN Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE Carrier Protein: None PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water Shipping: Room Temp Stability and Storage: Avoid repeated freeze-thaw cycles • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.
Migration Assay Protocol 
Activity: EC50 = 0.1-0.4 nM determined by Migration Assay with cells expressing recombinant CCR1
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
|
|
|
|
|
