Human CCL14 (HCC-1)
Cat Number: CCL14-5ug, CCL14-20ug, CCL14-50ug, CCL14-100ug, CCL14-1mg
Lyophilized sample, >97% Purity, EC50 = 0.1-0.4 nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)
                                           

Products Ship within 1-2 Business Days


​
Also available biotinylated: Human Biotinylated B-CCL14
BACKGROUND
Hemofiltrate CC chemokine-1 (HCC-1/CCL14) is endogeneously expressed by numerous tissues. Upon processing of the N terminal residues of the full length HCC-1 by the uPA-plasmin system, the active form of HCC-1 (made by ChemoTactics) is a strong agonist for CCR1, CCR5 and to a lesser extent CCR3, and causes chemotaxis of different types of leukocytes. The active form of HCC-1 is also shown as a potent inhibitor of HIV entry.

On Sale

On Sale

CCL14 (HCC-1)

$61.00 - $2,080.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 
SPECIFICATIONS

​Source: E. coli derived Accession # P16627 (28-93)
Modification: None
Formulation: Lyophilized​
Predicted Molecular Mass: 7.801 kDa
Extinction Coefficient: 13,850 M-1 cm-1
Actual Molecular Mass: 7.801 kDa by ESI Mass Spec
​​Protein Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR
GHSVCTN PSDKWVQDYIKDMKEN

Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
Carrier Protein: None

PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

Stability and Storage: Avoid repeated freeze-thaw cycles
             • 12 months from date of receipt, -20 to -70 °C as supplied.
             • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
             • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells.
Migration Assay Protocol
​Activity: EC50 = 0.1-0.4 nM determined by Migration Assay with cells expressing recombinant CCR1
For bulk orders or custom sizes, please contact us and we can provide this for you.

REFERENCES
1. “HCC-1, a novel chemokine from human plasma” Schulz-Knappe P.,  Mägert H., Dewald  B., J Exp Med 183:295-299 (1996)

2. “Urokinase Plasminogen Activator and Plasmin Efficiently Convert Hemofiltrate CC Chemokine 1 into Its Active [9–74] Processed Variant” Vakili J., Standker L., Detheux M., Vassart, G., Forssmann W., Parmentier M. J Immunol 167:3406-3413 (2001)

Chemokine Products

Support: [email protected]
For Research use only, Not for use in Humans.

Made in the USA