Recombinant Biotinylated Chemokine Proteins from ChemoTactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact

Human CCL27 (CTACK) 
Cat Number: CCL27-5ug, CCL27-20ug, CCL27-50ug, CCL27-100ug, CCL27-1mg
Lyophilized sample, >97% Purity, EC50 = 34nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)


​

​Products Ship within 1-2 Business Days

BACKGROUND
Cutaneous T-cell-attracting chemokine (CTACK/CCL27) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T cells during cutaneous inflammation.  Interestingly, after CCR10-mediated internalization, CTACK, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.

On Sale

On Sale

CCL27 (CTACK)

$61.00 - $2,080.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 

SPECIFICATIONS
Source: E. coli derived Accession # Q9Y4X3 (25-112)
Modification: None
Formulation: Lyophilized
Carrier Protein: None
Predicted Molecular Mass: 10.149 kDa
Extinction Coefficient: 7,450 M-1 cm-1
Actual Molecular Mass: 10.149kDa by ESI Mass Spec
Protein Sequence: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP
SLSQWFEHQERKLHGTLPKLNFGMLRKMG
Endotoxin Level:  <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
PREPARATION AND STORAGE
Reconstituion: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

​Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells.
Migration Assay Protocol
Picture
Activity: EC50 = 34nM determined by migration assay with cells expressing recombinant CCR10
For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order
REFERENCES
1. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Homey et al. Nature Med. 8: 157-165 (2002)

2. Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus. Ishikawa-Mochizuki et al. FEBS Lett. 460:544-548 (1999)

3. The Chemokine ESkine/CCL27 Displays Novel Modes of Intracrine and Paracrine Function. Gortz A. et al. J Immunol. 169:1387-1394 (2002)

Chemokine Products

Unlabeled Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1a)
  • CCL4 (MIP-1B)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3B)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1a)​
Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1a)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3B)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1a)-Biotin​

Support: [email protected]
For Research use only, Not for use in Humans.

 
Picture
​ChemoTactics, Inc
6076 Corte del Cedro Carlsbad,
​CA 92011 USA
Phone: +1-(858)-412-0485
​Email: [email protected]
Chemokine Products
Biotinylated Chemokines
Unconjugated Chemokines
Streptavidin Conjugates
Research Services
Resources​
Published Applications
Protocols
​Blog
About
​
Contact
Made in the USA
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact