Human CCL5 (RANTES)
|
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
|
SPECIFICATIONS
Source: E. coli derived Accession # P13501 (24-91) Modification: None Formulation: Lyophilized Carrier Protien: None Predicted Molecular Mass: 7.851 kDa Extinction Coefficient: 12,570 M-1 cm-1 Actual Molecular Mass: 7.851 kDa by ESI Mass Spec Protein Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water Shipping: Room Temp Stability and Storage: Avoid repeated freeze-thaw cycles • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of Rantes. Responses are expressed as the % of total input cells.
Migration Assay Protocol 
Activity: EC50 = 0.13nM determined by migration assay with cells expressing recombinant CCR5
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
|
|
|
|
|
REFERENCES
1. “RANTES: a versatile and controversial chemokine” Appay V., Rowland-Jones S.L. Trends Immunol 22:83-87 (2001)
2. “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive fac tors produced by CD8+T cells” Cocchi F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. A human T cell-specific molecule is a member of a new gene family. Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M. J Immunol 141:1018-1025 (1988)
4. “Engineering the glycosaminoglycan-binding affinity, kinetics and oligomerization behavior of RANTES: a tool for generating chemokine-based glycosaminoglycan antagonists” Brandner B., Rek A., Diedrichs-Möhring M., Wildner G., Kungl A.J. Protein Eng Des Sel. 22:367-373 (2009)
1. “RANTES: a versatile and controversial chemokine” Appay V., Rowland-Jones S.L. Trends Immunol 22:83-87 (2001)
2. “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive fac tors produced by CD8+T cells” Cocchi F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. A human T cell-specific molecule is a member of a new gene family. Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M. J Immunol 141:1018-1025 (1988)
4. “Engineering the glycosaminoglycan-binding affinity, kinetics and oligomerization behavior of RANTES: a tool for generating chemokine-based glycosaminoglycan antagonists” Brandner B., Rek A., Diedrichs-Möhring M., Wildner G., Kungl A.J. Protein Eng Des Sel. 22:367-373 (2009)
