Recombinant Biotinylated Chemokine Proteins from ChemoTactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blogs
  • About
    • Contact

Human CCL19 (MIP-3β)
Cat Number: CCL19-5ug, CCL19-20ug, CCL19-50ug, CCL19-100ug, CCL19-1mg
Lyophilized sample, >97% Purity, EC50 = 7.2 nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)

​
Products Ship within 1-2 Business Days

​
Also available biotinylated: Human Biotinylated B-CCL19

BACKGROUND
Macrophage inflammatory protein-3-beta (MIP-3β/CCL19), also known as EBI1 ligand chemokine (ELC), directs chemotaxis of dendritic cells, and certain B- and T- lymphocytes, but not monocytes or granulocytes. It is constituitively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. Being a homeostatic chemokine, its primary physiological role is considered to be in the normal recirculation and homing of lymphocyte. However, MIP-3β could also be proinflammatory, and is implicated in the post-HIV infection responses.

On Sale

On Sale

CCL19 (MIP-3β)

$61.00 - $2,080.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 

SPECIFICATIONS
Source: E. coli derived Accession # P99731 (22-98)
Modification: None
Formulation: Lyophilized
Carrier Protein: None
Predicted Molecular Mass: 8.800 kDa
Extinction Coefficient: 8,730 M-1 cm-1
Actual Molecular Mass: 8.800 kDa by ESI Mass Spec
Protein Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

Stability and Storage: Avoid repeated freeze-thaw cycles
             • 12 months from date of receipt, -20 to -70 °C as supplied.
             • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
             • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3β. Responses are expressed as the % of total input cells.
Migration Assay Protocol
Picture
​Activity: EC50 = 7.2nM determined by migration assay with cells expressing recombinant CCR7
For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order
REFERENCES
1. “Molecular Cloning of a Novel Human CC Chemokine EBI1-ligand Chemokine That Is a Specific Functional Ligand for EBI1, CCR7” Yoshida R., Imai T., Hieshima K., Kusuda J., Baba M., Kitaura M., Nishimura M., Kakizaki M., Nomiyama H., Yoshie O.J Biol Chem 272:13803-13809 (1997)

2. "CK beta-11/macrophage inflammatory protein-3 beta/EBI1-ligand chemokine is an efficacious chemoattractant for T and B cells."Kim C.H., Pelus L.M., White J.R., Applebaum E., Johanson K., Broxmeyer H.E. J. Immunol. 160:2418-2424(1998)

3. “Homeostatic chemokines CCL19 and CCL21 promote inflammation in human immunodeficiency virus-infected patients with ongoing viral replication.” Damås J.K., Landrø L., Fevang B., Heggelund L., Tjønnfjord G.E., Fløisand Y., Halvorsen B., Frøland S.S., Aukrust P. Clin Exp Immunol.  157:400-7 (2009)

Chemokine Products

Unlabeled Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1a)
  • CCL4 (MIP-1B)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3B)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1a)​
Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1a)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3B)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1a)-Biotin​

Support: [email protected]
For Research use only, Not for use in Humans.

Picture
​ChemoTactics, Inc
6076 Corte del Cedro Carlsbad,
​CA 92011 USA
Phone: +1-(858)-412-0485
​Email: [email protected]
Chemokine Products
Biotinylated Chemokines
Unconjugated Chemokines
Streptavidin Conjugates
Research Services
Resources​
Published Applications
Protocols
​Blog
About
​
Contact
Made in the USA
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blogs
  • About
    • Contact