Recombinant Biotinylated Chemokine Proteins from ChemoTactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact

Human CXCL8 (IL-8)
Cat Number: CXCL8-5ug, CXCL8-20ug, CXCL8-50ug, CXCL8-100ug, CXCL8-1mg
Lyophilized sample, >97% Purity, EC50 = 0.083nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)


​Products Ship within 1-2 Business Days


​Also available biotinylated: Human Biotinylated B-CXCL8

BACKGROUND
Interleukin 8 (IL-8 /CXCL8) is secreted primarily by macrophages and monocytes.  It is one of the key mediators for inflammatory responses. IL-8 is a strong chemotractant for neutrophils and monocytes promoting activation of these cells by binding to two cell surface receptors, CXCR1 and CXCR2. It is also a strong angiogenic agent and is considered to play a role in the pathogenesis of bronchiolitis.

On Sale

On Sale

CXCL8 (IL-8)

$61.00 - $2,080.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 

SPECIFICATIONS
Source: E. coli derived Accession # P10145 (28-99)
Modification: None
Formulation: Lyophilized
Carrier Protein: None
Predicted Molecular Mass: 8.386 kDa
Extinction Coefficient: 7,450 M-1 cm-1
Actual Molecular Mass: 8.386 kDa by ESI Mass Spec
Protein Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAEN
Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
PREPARATION AND STORAGE
Reconstitution: Spin tube prior to resuspension. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

Stability and Storage:  Avoid repeated freeze-thaw cycles
             • 12 months from date of receipt, -20 to -70 °C as supplied.
             • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
             • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Cells expressing recombinant CXCR1 were assayed for migration through a transwell filter at various concentrations of WT IL-8. Responses are expressed as the % of total input cells.
Migration Assay Protocol
Picture
Activity: EC50 = 0.083 nM determined by migration assay with cells expressing recombinant CXCR1 ​
REFERENCES
1. “Interleukin-8, a chemotactic and inflammatory cytokine” Baggiolini M., Clark-Lewis I. FEBS Lett. 307:97-101(1992)

2.  “Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction MDNCF mRNA by interleukin 1 and tumor necrosis factor” Matsushima K., Morishita K., Yoshimura T., Lavu S., Kobayashi Y., Lew W., Appella E., Kung H., Leonard E.J., Oppenheim J.J. J. Exp. Med. 167:1883-1893(1988)

3. “Chemokines, CXC|IL-8” Strieter R.M., Keane M.P., Belperio J. A. Encyclopedia of respiratory medicine, Academic Press, Oxford, P395-398(2006)
For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order

Chemokine Products

Unlabeled Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1a)
  • CCL4 (MIP-1B)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3B)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1a)​
Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1a)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3B)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1a)-Biotin​

Support: [email protected]
For Research use only, Not for use in Humans.

Picture
​ChemoTactics, Inc
6076 Corte del Cedro Carlsbad,
​CA 92011 USA
Phone: +1-(858)-412-0485
​Email: [email protected]
Chemokine Products
Biotinylated Chemokines
Unconjugated Chemokines
Streptavidin Conjugates
Research Services
Resources​
Published Applications
Protocols
​Blog
About
​
Contact
Made in the USA
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact