Human CXCL8 (IL-8)
|
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
|
SPECIFICATIONS
Source: E. coli derived Accession # P10145 (28-99) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 8.386 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 8.386 kDa by ESI Mass Spec Protein Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAEN Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE PREPARATION AND STORAGE
Reconstitution: Spin tube prior to resuspension. Recommended at 100μg/mL in sterile water Shipping: Room Temp Stability and Storage: Avoid repeated freeze-thaw cycles • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Migration Assay: Cells expressing recombinant CXCR1 were assayed for migration through a transwell filter at various concentrations of WT IL-8. Responses are expressed as the % of total input cells.
Migration Assay Protocol Activity: EC50 = 0.083 nM determined by migration assay with cells expressing recombinant CXCR1
|
REFERENCES
1. “Interleukin-8, a chemotactic and inflammatory cytokine” Baggiolini M., Clark-Lewis I. FEBS Lett. 307:97-101(1992)
2. “Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction MDNCF mRNA by interleukin 1 and tumor necrosis factor” Matsushima K., Morishita K., Yoshimura T., Lavu S., Kobayashi Y., Lew W., Appella E., Kung H., Leonard E.J., Oppenheim J.J. J. Exp. Med. 167:1883-1893(1988)
3. “Chemokines, CXC|IL-8” Strieter R.M., Keane M.P., Belperio J. A. Encyclopedia of respiratory medicine, Academic Press, Oxford, P395-398(2006)
1. “Interleukin-8, a chemotactic and inflammatory cytokine” Baggiolini M., Clark-Lewis I. FEBS Lett. 307:97-101(1992)
2. “Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction MDNCF mRNA by interleukin 1 and tumor necrosis factor” Matsushima K., Morishita K., Yoshimura T., Lavu S., Kobayashi Y., Lew W., Appella E., Kung H., Leonard E.J., Oppenheim J.J. J. Exp. Med. 167:1883-1893(1988)
3. “Chemokines, CXC|IL-8” Strieter R.M., Keane M.P., Belperio J. A. Encyclopedia of respiratory medicine, Academic Press, Oxford, P395-398(2006)
For bulk orders or custom sizes, please contact us and we can provide this for you.
Chemokine Products
|
|
|
|
|
|
