Recombinant Biotinylated Chemokine Proteins from ChemoTactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact

Human CXCL10 (IP-10) 
Cat Number: CXCL10-5ug, CXCL10-20ug, CXCL10-50ug, CXCL10-100ug, CXCL10-1mg
Lyophilized sample, >97% Purity, EC50 = 6.3nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)



​Products Ship within 1-2 Business Days

On Sale

On Sale

CXCL10 (IP-10)

$61.00 - $2,080.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 
BACKGROUND
CXCL10 (IP-10) was originally identified as an IFN-gamma-inducible gene in endothelial, fibroblasts and monocytes cells. IP-10 is considered a member of the CXC chemokine subfamily from its protein sequence which includes the four conserved cysteine residues present in CXC chemokines. IP-10 signals through the CXCR3 receptor to selectively attract Th1 lymphocytes and monocytes. It also has angiostatic and mitogenic properties on vascular smooth muscle cells. A diverse population of cell types rapidly increases transcription of mRNA encoding IP-10, which suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.

Disease Areas: Auto immune disorders, Cardiovascular disorders, Angiogenesis, Neurobiology

SPECIFICATIONS
Source: E. coli derived Accession # P02778 (22-98)
Modification: None
Formulation: Lyophilized
Carrier Protein: None
Actual Molecular Mass: 8.6 kDa by ESI Mass Spec
Predicted Molecular Mass: 8.6 kDa
Extinction Coefficient: 480 M-1 cm-1 (A280), 11 (mg/ml•cm)-1 (A220)
Protein Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA
IKNLLKAVSKERSKRSP
Endotoxin Level:  <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells.
Migration Assay Protocol
Picture
​

Activity: EC50 = 6.3nM determined by migration assay with cells expressing recombinant CXCR3 receptors
For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order
REFERENCES
1.  "Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins."
      Luster A.D., Unkeless J.C., Ravetch J.V. Nature 315:672-676(1985)

2.   "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
         The MGC Project Team. Genome Res. 14:2121-2127(2004)

3.   "Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO,
      IP-10, and IL-8." Proost P., de Wolf-Peeters C., Conings R., Opdenakker G., Billiau A., van Damme J. J. Immunol. 150:1000-1010(1993)

4.  "Human IP-9: a keratinocyte derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3)."
      Tensen C.P., Flier J., van der Raaij-Helmer E.M.H., Sampat-Sardjoepersad S., van der Schors R.C., Leurs R., Scheper R.J., Boorsma D.M., Willemze R. 
       J. Invest. Dermatol. 112:716-722(1999)

5.   "Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity."
      Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P.
      Eur. J. Biochem. 268:4992-4999(2001)

6.   "Citrullination of CXCL10 and CXCL11 by peptidylarginine deiminase: a naturally occurring posttranslational modification of chemokines and new dimension of immunoregulation."
      Loos T., Mortier A., Gouwy M., Ronsse I., Put W., Lenaerts J.P., Van Damme J., Proost P. Blood 112:2648-2656(2008)

7.   "The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions."
    Booth V., Keizer D.W., Kamphuis M.B., Clark-Lewis I., Sykes B.D. Biochemistry 41:10418-10425(2002)

Chemokine Products

Unlabeled Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1α)
  • CCL4 (MIP-1β)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3β)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1α)​
Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1α)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3β)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1α)-Biotin​

Support: [email protected]
For Research use only, Not for use in Humans.

 
Picture
​ChemoTactics, Inc
6076 Corte del Cedro Carlsbad,
​CA 92011 USA
Phone: +1-(858)-412-0485
​Email: [email protected]
Chemokine Products
Biotinylated Chemokines
Unconjugated Chemokines
Streptavidin Conjugates
Research Services
Resources​
Published Applications
Protocols
​Blog
About
​
Contact
Made in the USA
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact