Human CCL4 (MIP-1β)
Catalog Numbers: CCL4-5ug, CCL4-20ug, CCL4-50ug, CCL4-100ug, CCL4-1mg Lyophilized sample, >97% Purity, EC50 = 0.23 nM ![]() Product Data Sheet (PDF)
Safety Data Sheet (PDF) Products ship within 1-2 business days Also available biotinylated: Human Biotinylated B-CCL4 |
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
BACKGROUND
Monokine with inflammatory and chemokinetic properties binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Monokine with inflammatory and chemokinetic properties binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
SPECIFICATIONS
Source: E. coli derived Accession # P13236 (24-92) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 7.818 kDa Extinction Coefficient: 12,570 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.818 kDa by ESI Mass Spec Protein Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE |
Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.
Migration Assay Protocol ![]() Activity: EC50 = 0.23nM determined by Migration Assay with cells expressing recombinant CCR5
|
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile DMSO.
Shipping: Room Temp
Stability and Storage:
Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile DMSO.
Shipping: Room Temp
Stability and Storage:
Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
|
|
|
|
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
REFERENCES
1. "Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells."
Cocchi F., DeVico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P.
Science 270:1811-1815 (1995)
2. "The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8."
Garlisi C.G., Xiao H., Tian F., Hedrick J.A., Billah M.M., Egan R.W., Umland S.P.
Eur. J. Immunol. 29:3210-3215 (1999)
3. "Natural truncation of the chemokine MIP-1beta/CCL4 affects receptor specificity but not anti-HIV-1 activity."
Guan E., Wang J., Roderiquez G., Norcross M.A.
J. Biol. Chem. 277:32348-32352 (2002)
1. "Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells."
Cocchi F., DeVico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P.
Science 270:1811-1815 (1995)
2. "The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8."
Garlisi C.G., Xiao H., Tian F., Hedrick J.A., Billah M.M., Egan R.W., Umland S.P.
Eur. J. Immunol. 29:3210-3215 (1999)
3. "Natural truncation of the chemokine MIP-1beta/CCL4 affects receptor specificity but not anti-HIV-1 activity."
Guan E., Wang J., Roderiquez G., Norcross M.A.
J. Biol. Chem. 277:32348-32352 (2002)