Human CCL28 (MEC)
|
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
BACKGROUND
Mucosae-associated epithelial chemokine (MEC/CCL28) is secreted by epithelial cells of gastrointestinal and nonintestinal mucosal cells, and regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. It shows broad-spectrum antibacterial activities, and could also be useful in vaccination of HIV infection.
Mucosae-associated epithelial chemokine (MEC/CCL28) is secreted by epithelial cells of gastrointestinal and nonintestinal mucosal cells, and regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. It shows broad-spectrum antibacterial activities, and could also be useful in vaccination of HIV infection.
SPECIFICATIONS
Source: E. coli derived Accession # Q9NRJ3 (23-127) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 12.031 kDa Extinction Coefficient: 8,970 M-1 cm-1 Actual Molecular Mass: 12.031kDa by ESI Mass Spec Protein Sequence: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVK QWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE |
Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of MEC. Responses are expressed as the % of total input cells.
Migration Assay Protocol Activity: EC50 = 38nM determined by migration assay with cells expressing recombinant CCR10
|
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp
Stability and Storage: Avoid repeated freeze-thaw cycles
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution.
|
|
|
|
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
REFERENCES
1. “A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues” Pan et al. J. Immunol. 165: 2943–2949 (2000)
2. Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2). Wang et al. J. Biol. Chem. 275: 22313–22323 (2000)
3. “The Mucosae-Associated Epithelial Chemokine (MEC/CCL28) Modulates Immunity in HIV Infection” Castelletti E. at al. PLoS ONE 2:e969 (2007)
1. “A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues” Pan et al. J. Immunol. 165: 2943–2949 (2000)
2. Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2). Wang et al. J. Biol. Chem. 275: 22313–22323 (2000)
3. “The Mucosae-Associated Epithelial Chemokine (MEC/CCL28) Modulates Immunity in HIV Infection” Castelletti E. at al. PLoS ONE 2:e969 (2007)