• Chemotactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Chemokine Resources
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • ChemoTactics Blog
  • About
    • Distributor Login
  • Contact
Chemokines by ChemoTactics

Human CCL3 (MIP-1α)
Catalog Number: CCL3-5ug, CCL3-20ug, CCL3-50ug, CCL3-100ug, CCL3-1mg
Lyophilized sample, >97% Purity, EC50 = 0.1-0.3 nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)



​Products ship within 1-2 business days. 

​Also available biotinylated:
 Human Biotinylated B-CCL3


On Sale

On Sale

CCL3 (MIP-1a)

$47.20 - $1,700.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 
BACKGROUND
Macrophage inflammatory proteins 1-α (MIP-1α/CCL3) binds to cell surface receptors CCR1 and CCR5. It is a proinflammatory chemokine, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection.

SPECIFICATIONS

​Source: E. coli derived Accession # P10147 (24-92)
Modification: None
Formulation: Lyophilized
Carrier Protein: None


Predicted Molecular Mass: 7.716 kDa
Extinction Coefficient: 10,010 M-1 cm-1
Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec


Protein Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE
EWV​QKYVSDLELSA

​
Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE

Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1α. Responses are expressed as the % of total input cells.
Migration Assay Protocol
Picture
Activity: EC50 = 0.1-0.3 nM determined by migration assay with cells expressing recombinant CCR5 ​
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

​Stability and Storage: Avoid repeated freeze-thaw cycles
             • 12 months from date of receipt, -20 to -70 °C as supplied.
             • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
             • 3 months, -20 to -70 °C under sterile conditions after reconstitution.

CCL3 (MIP-1a)

$2,125.00 $1,700.00
Add to Cart

CCL3 (MIP-1a)

$468.00 $374.40
Add to Cart

CCL3 (MIP-1a)

$298.00 $238.40
Add to Cart

CCL3 (MIP-1a)

$136.00 $108.80
Add to Cart

CCL3 (MIP-1a)

$59.00 $47.20
Add to Cart
​For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order
REFERENCES
​1. “Macrophage inflammatory protein-1” Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)

2.  “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells” Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)

3. “Identification and characterization of an inhibitor of haemopoietic stem cell proliferation” Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)

4. “Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors” Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)
Other Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1α)
  • CCL4 (MIP-1β)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3β)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1α)
Other Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1α)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3β)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1α)-Biotin

Support: info@chemotactics.com
For Research use only, Not for use in Humans.

ChemoTactics, Inc. 
6076 Corte Del Cedro
Carlsbad, CA 92011 USA

Phone: (858)-412-0485

Picture
Products          Resources
Contact              About