Recombinant Biotinylated Chemokine Proteins from ChemoTactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blogs
  • About
    • Contact

Human CCL3 (MIP-1α)
Catalog Number: CCL3-5ug, CCL3-20ug, CCL3-50ug, CCL3-100ug, CCL3-1mg
Lyophilized sample, >97% Purity, EC50 = 0.1-0.3 nM

Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)



​Products ship within 1-2 business days. 

​Also available biotinylated:
 Human Biotinylated B-CCL3


BACKGROUND
Macrophage inflammatory proteins 1-α (MIP-1α/CCL3) binds to cell surface receptors CCR1 and CCR5. It is a proinflammatory chemokine, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection.

On Sale

On Sale

CCL3 (MIP-1a)

$61.00 - $2,080.00
Shop
​​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 

SPECIFICATIONS

​Source: E. coli derived Accession # P10147 (24-92)
Modification: None
Formulation: Lyophilized
Carrier Protein: None
Predicted Molecular Mass: 7.716 kDa
Extinction Coefficient: 10,010 M-1 cm-1
Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec
Protein Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE
EWV​QKYVSDLELSA

Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

​Stability and Storage: Avoid repeated freeze-thaw cycles
             • 12 months from date of receipt, -20 to -70 °C as supplied.
             • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
             • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1α. Responses are expressed as the % of total input cells.
Migration Assay Protocol
Picture
Activity: EC50 = 0.1-0.3 nM determined by migration assay with cells expressing recombinant CCR5 ​
​For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order
REFERENCES
​1. “Macrophage inflammatory protein-1” Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)

2.  “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells” Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)

3. “Identification and characterization of an inhibitor of haemopoietic stem cell proliferation” Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)

4. “Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors” Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)

Chemokine Products

Other Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1a)
  • CCL4 (MIP-1B)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3B)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1a)
Other Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1a)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3B)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1a)-Biotin

Support: [email protected]
For Research use only, Not for use in Humans.

Picture
​ChemoTactics, Inc
6076 Corte del Cedro Carlsbad,
​CA 92011 USA
Phone: +1-(858)-412-0485
​Email: [email protected]
Chemokine Products
Biotinylated Chemokines
Unconjugated Chemokines
Streptavidin Conjugates
Research Services
Resources​
Published Applications
Protocols
​Blog
About
​
Contact
Made in the USA
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blogs
  • About
    • Contact