Human CCL3 (MIP-1α)
|
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
|
SPECIFICATIONS
Source: E. coli derived Accession # P10147 (24-92) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 7.716 kDa Extinction Coefficient: 10,010 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec Protein Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWVQKYVSDLELSA Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE PREPARATION AND STORAGE
Reconstitution: Spin sample prior to reconstitution. Recommended at 100μg/mL in sterile water Shipping: Room Temp Stability and Storage: Avoid repeated freeze-thaw cycles • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1α. Responses are expressed as the % of total input cells.
Migration Assay Protocol 
Activity: EC50 = 0.1-0.3 nM determined by migration assay with cells expressing recombinant CCR5
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
|
|
|
|
|
REFERENCES
1. “Macrophage inflammatory protein-1” Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)
2. “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells” Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. “Identification and characterization of an inhibitor of haemopoietic stem cell proliferation” Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)
4. “Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors” Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)
1. “Macrophage inflammatory protein-1” Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)
2. “Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells” Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. “Identification and characterization of an inhibitor of haemopoietic stem cell proliferation” Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)
4. “Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors” Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)
