Recombinant Biotinylated Chemokine Proteins from ChemoTactics
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact
Human CXCL12 (SDF-1α)
Cat Numbers: CXCL12a-5ug, CXCL12a-20ug, CXCL12a-50ug, CXCL12a-100ug, CXCL12a-1mg
Lyophilized sample, >97% Purity, EC50 = 0.1-0.25nM
Picture
Product Data Sheet (PDF)
Safety Data Sheet (PDF)



​
Products Ship within 1-2 Business Days​


Also available biotinylated: Human Biotinylated B-CXCL12

On Sale

On Sale

CXCL12 (SDF-1α)

$61.00 - $2,080.00
Shop
​Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg 
Also available in custom sizes, email for a custom quote. 
BACKGROUND
Stromal-Cell Derived Factor-1α (SDF-1α) (CXCL12) attracts lymphocytes and plays important roles in embryogenesis and angiogenesis with implications in tumor metastasis. By binding to CXCR4, one of the co-receptors for HIV viral entry, SDF-1α can suppress HIV. Besides CXCR4, SDF-1α also binds to the “decoy” receptor CXCR7, and activates the downstream β-arrestin- rather than G protein-mediated signaling pathway.

SPECIFICATIONS
Source: E. coli derived Accession # P48061-2 (22-89)
Modification: None
Formulation: Lyophilized
Carrier Protein: None
Predicted Molecular Mass: 7.963 kDa
Extinction Coefficient: 8,730 M-1 cm-1
Actual Molecular Mass: 7.98 kDa by ESI Mass Spec
​Protein Sequence:
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKL
​KWIQEYLEKALNK
Endotoxin Level:  <0.01 EU per 1μg of the protein by the LAL method
Purity:  > 97% by SDS PAGE
PREPARATION AND STORAGE
Reconstitution: Spin tube prior to resuspension. Recommended at 100μg/mL in sterile water
Shipping: Room Temp

Stability and Storage: Avoid repeated freeze-thaw cycles
           • 12 months from date of receipt, -20 to -70 °C as supplied.
           • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
           • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1α. Responses are expressed as the % of total input cells 
Migration Assay Protocol
Picture
​Activity: EC50 = 0.1-0.25nM determined by migration assay with cells expressing recombinant CXCR4
For bulk orders or custom sizes, please contact us and we can provide this for you.
Custom Order
REFERENCES
1. "A highly efficacious lymphocyte chemoattractant, stromal cell-derived factor 1 (SDF-1)." Bleul. C, Fuhlbrigge. R, Casasnovas, J, Aiuti. A, Springer, T. J. Exp. Med. 184 (3): 1101–9. (1996)

2. "The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry". Bleul. C, Farzan, M., Choe, H., Parolin C., Clark-Lewis I., Sodroski J. Nature 382 (6594): 829–833 (1996)

3.  "Clinical importance and therapeutic implications of the pivotal CXCL12-CXCR4 (chemokine ligand-receptor) interaction in cancer cell migration." Arya, M., Ahmed, H., Silhi, Williamson, M., Patel, H.  Tumour Biol. 28 (3): 123–31 (2007)

4.  “β-arrestin- but not G protein –mediated signaling by the “decoy” receptor CXCR7.” Rajagopal, S., Kim, J., Ahn, S., Craig, S., lam, C., Gerard, N., Gerard, C., Lefkowitz, R. Proc Natl Acad Sci USA 107(2):628-632 (2010)

Chemokine Products

Unlabeled Chemokines
  • ​CCL2 (MCP-1)
  • CCL3 (MIP-1a)
  • CCL4 (MIP-1B)
  • CCL5 (Rantes)
  • CCL7 (MCP-3)
  • CCL14 (HCC-1)
  • CCL19 (MIP-3B)
  • CCL27 (CTACK)
  • CCL28 (MEC)
  • CXCL8 (IL-8)
  • CXCL10 (IP-10)
  • CXCL12 (SDF-1a)​
Biotinylated Chemokines
  • CCL2 (MCP-1)-Biotin
  • CCL3 (MIP-1a)-Biotin
  • CCL4 (MIP-1B)-Biotin
  • CCL5 (Rantes)-Biotin
  • CCL7 (MCP-3)-Biotin
  • CCL14 (HCC-1)-Biotin
  • CCL19 (MIP-3B)-Biotin
  • CCL28 (MEC)-Biotin
  • CXCL8 (IL-8)-Biotin
  • CXCL12 (SDF-1a)-Biotin​

Support: [email protected]
For Research use only, Not for use in Humans.

Picture
​ChemoTactics, Inc
6076 Corte del Cedro Carlsbad,
​CA 92011 USA
Phone: +1-(858)-412-0485
​Email: [email protected]
Chemokine Products
Biotinylated Chemokines
Unconjugated Chemokines
Streptavidin Conjugates
Research Services
Resources​
Published Applications
Protocols
​Blog
About
​
Contact
Made in the USA
  • Chemokine Products
    • Biotinylated Chemokines >
      • Biotinylated CCL2 (MCP-1)
      • Biotinylated CCL3 (MIP-1α)
      • Biotinylated CCL4 (MIP-1β)
      • Biotinylated CCL5 (Rantes)
      • Biotinylated CCL7 (MCP-3)
      • Biotinylated CCL14 (HCC-1)
      • Biotinylated CCL19 (MIP-3β)
      • Biotinylated CCL28 (MEC)
      • Biotinylated CXCL8 (IL-8)
      • Biotinylated CXCL12 (SDF-1α)
    • Unmodified Chemokines >
      • CCL2 (MCP-1)
      • CCL3 (MIP-1α)
      • CCL4 (MIP-1β)
      • CCL5 (RANTES)
      • CCL7 (MCP-3)
      • CCL14 (HCC-1)
      • CCL19 (MIP-3β)
      • CCL27 (CTACK)
      • CCL28 (MEC)
      • CXCL8 (IL-8)
      • CXCL10 (IP-10)
      • CXCL12 (SDF-1α)
  • Streptavidin Conjugates
  • Services
  • Resources
    • Published Applications Biotinylated CXCL12 and CCL5
    • What are Chemokines?
    • Chemokine Protocols >
      • Flow Cytometry with Biotinylated Chemokines
      • ELISA with Biotinylated Chemokines
      • Transwell Migration Assay
    • Blog
  • About
    • Contact