Human CXCL12 (SDF-1α)
|
Cat Numbers: CXCL12a-5ug, CXCL12a-20ug, CXCL12a-50ug, CXCL12a-100ug, CXCL12a-1mg
Lyophilized sample, >97% Purity, EC50 = 0.1-0.25nM 
Product Data Sheet (PDF)
Safety Data Sheet (PDF) Products Ship within 1-2 Business Days Also available biotinylated: Human Biotinylated B-CXCL12 |
Stock Sizes: 5ug, 20ug, 50ug, 100ug, and 1mg
Also available in custom sizes, email for a custom quote. |
BACKGROUND
Stromal-Cell Derived Factor-1α (SDF-1α) (CXCL12) attracts lymphocytes and plays important roles in embryogenesis and angiogenesis with implications in tumor metastasis. By binding to CXCR4, one of the co-receptors for HIV viral entry, SDF-1α can suppress HIV. Besides CXCR4, SDF-1α also binds to the “decoy” receptor CXCR7, and activates the downstream β-arrestin- rather than G protein-mediated signaling pathway.
Stromal-Cell Derived Factor-1α (SDF-1α) (CXCL12) attracts lymphocytes and plays important roles in embryogenesis and angiogenesis with implications in tumor metastasis. By binding to CXCR4, one of the co-receptors for HIV viral entry, SDF-1α can suppress HIV. Besides CXCR4, SDF-1α also binds to the “decoy” receptor CXCR7, and activates the downstream β-arrestin- rather than G protein-mediated signaling pathway.
|
SPECIFICATIONS
Source: E. coli derived Accession # P48061-2 (22-89) Modification: None Formulation: Lyophilized Carrier Protein: None Predicted Molecular Mass: 7.963 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 7.98 kDa by ESI Mass Spec Protein Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKL KWIQEYLEKALNK Endotoxin Level: <0.01 EU per 1μg of the protein by the LAL method Purity: > 97% by SDS PAGE PREPARATION AND STORAGE
Reconstitution: Spin tube prior to resuspension. Recommended at 100μg/mL in sterile water Shipping: Room Temp Stability and Storage: Avoid repeated freeze-thaw cycles • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1α. Responses are expressed as the % of total input cells
Migration Assay Protocol 
Activity: EC50 = 0.1-0.25nM determined by migration assay with cells expressing recombinant CXCR4
|
For bulk orders or custom sizes, please contact us and we can provide this for you.
|
|
|
|
|
|
REFERENCES
1. "A highly efficacious lymphocyte chemoattractant, stromal cell-derived factor 1 (SDF-1)." Bleul. C, Fuhlbrigge. R, Casasnovas, J, Aiuti. A, Springer, T. J. Exp. Med. 184 (3): 1101–9. (1996)
2. "The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry". Bleul. C, Farzan, M., Choe, H., Parolin C., Clark-Lewis I., Sodroski J. Nature 382 (6594): 829–833 (1996)
3. "Clinical importance and therapeutic implications of the pivotal CXCL12-CXCR4 (chemokine ligand-receptor) interaction in cancer cell migration." Arya, M., Ahmed, H., Silhi, Williamson, M., Patel, H. Tumour Biol. 28 (3): 123–31 (2007)
4. “β-arrestin- but not G protein –mediated signaling by the “decoy” receptor CXCR7.” Rajagopal, S., Kim, J., Ahn, S., Craig, S., lam, C., Gerard, N., Gerard, C., Lefkowitz, R. Proc Natl Acad Sci USA 107(2):628-632 (2010)
1. "A highly efficacious lymphocyte chemoattractant, stromal cell-derived factor 1 (SDF-1)." Bleul. C, Fuhlbrigge. R, Casasnovas, J, Aiuti. A, Springer, T. J. Exp. Med. 184 (3): 1101–9. (1996)
2. "The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry". Bleul. C, Farzan, M., Choe, H., Parolin C., Clark-Lewis I., Sodroski J. Nature 382 (6594): 829–833 (1996)
3. "Clinical importance and therapeutic implications of the pivotal CXCL12-CXCR4 (chemokine ligand-receptor) interaction in cancer cell migration." Arya, M., Ahmed, H., Silhi, Williamson, M., Patel, H. Tumour Biol. 28 (3): 123–31 (2007)
4. “β-arrestin- but not G protein –mediated signaling by the “decoy” receptor CXCR7.” Rajagopal, S., Kim, J., Ahn, S., Craig, S., lam, C., Gerard, N., Gerard, C., Lefkowitz, R. Proc Natl Acad Sci USA 107(2):628-632 (2010)
